PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00993g00033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 363aa    MW: 41161.2 Da    PI: 6.5198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00993g00033.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.4e-32223278156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k+r++W+peLH+rFv a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  Peaxi162Scf00993g00033.1 223 KQRRCWSPELHRRFVAALHQLGGAQVATPKQIREIMKVDGLTNDEVKSHLQKYRLH 278
                               79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-30220281IPR009057Homeodomain-like
PROSITE profilePS5129414.671220280IPR017930Myb domain
SuperFamilySSF466894.61E-18221281IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-26223278IPR006447Myb domain, plants
PfamPF002495.5E-7225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MCSNSKEMNI DLNFVYVPKI ISDVLTEVSA IDDISKKLSK LNSFAFSLED ELKKIEGFKR  60
ELPLCMLLLK DAIERLKEEA LQYKGKNKSP VMGEFIPLKV NSDESGRVKK SNDISDKKNW  120
MSSVQLWSTP VHYESSDFEK KGHFLQLKSS GVEEKERENQ YGRGAFVPFP EKSVVKEEKD  180
GIAVEELSLC MTVGEGEKGK NPIDVKRDEG KSNGYLQDKS QRKQRRCWSP ELHRRFVAAL  240
HQLGGAQVAT PKQIREIMKV DGLTNDEVKS HLQKYRLHVR RVPITSCSWS TMDEHEHEHG  300
ESSKTNATQS GSPEGPLHFN GSAKGMSTND GETMEENDQE EDNKSESYTN WNGQHPKSIE  360
AHV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487914.10.0PREDICTED: uncharacterized protein LOC107807956
TrEMBLM1AMN51e-175M1AMN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000260961e-174(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-55G2-like family protein